Premium Essay

Analysis of Alzheimer’s Disease Based on the D.N. Case Study.

In: Science

Submitted By etka81
Words 1212
Pages 5
Analysis of Alzheimer’s Disease based on the D.N. case study.

D.N. developed Alzheimer’s disease at age 50. Early signs were vague and included

occasional errors in judgment and increased criticism of others, noted only in retrospect.

Several years later, following several episodes of extreme anger, a diagnosis of

Alzheimer was made. At this time, it was suspected that his father also had AD but had

died from an unrelated cause before the diagnosis was could be made […]

The neurologist prescribed gelantamine, an anticholinesterase inhibitors and regular

attendance at a group center offering appropriate activities […] The degeneration

progresses rapidly over the next 2 years. The maximum dose of galantamine is no longer

effective. He is confused about any change and not capable of performing simple

activities. Communication is impaired, including that with family members […]

(Gould, Dyer, 2010 p.527)

Although aging is a natural part of human existence, it is also considered the most

difficult phase of ones life. Social, psychological and financial factors may remind a

person that the quality of their every day is not what it used to be, but the physical

changes that take place in the human body are the ones that affect aged people the most.

Among a long list of conditions and diseases that are prevalent in the elderly population,

forms of dementia are the ones that not only lead to unavoidable health impairment but

also involve neurological changes that disturb personality and cognitive processes.

Dementia is a “progressive chronic disease in which cortical function is

decreased, impairing cognitive skills such as language and innumeracy, logical thinking

[…] and motor coordination”. The condition can be caused by several different factors

and have different forms ranging in severity…...

Similar Documents

Premium Essay

Alzheimer's Disease

...to Patients with Alzheimer’s Disease Megan Zann April 27, 2012 Health Psychology Dr. Ackerman Introduction It is normal to periodically forget your keys or a homework assignment, because you generally remember these things later. However, individuals who suffer from Alzheimer’s disease may forget things more often, but they do not remember them again. The incidence of Alzheimer’s disease has dramatically increased because people are living longer. This is a result of advancements in medical technology that are increasing the human life span. That being said, now there is more responsibility placed on the individual and their caregivers to provide a supportive environment to combat this disease. Alzheimer’s disease is a progressive brain disorder that causes a gradual, irreversible cognitive deterioration. The individual experiences a significant decline in their memory, language skills, perception of space and eventually, their ability to be self-sufficient and independent. Alzheimer’s disease takes a toll on the patients as well as their caregivers. “Being a caregiver for an ill or disabled loved one is widely recognized as a threat to caregiver’s quality of life” (Poulin et al 2010). The diagnosis of this disease affects the caregivers on physical, psychological, and social levels. Family, friends, and caregivers suffer from pain and stress as they witness their loved one experiencing the progression of the disease. Background “Alzheimer’s disease is the most......

Words: 3180 - Pages: 13

Premium Essay

Infectious Disease Case Study

...Infectious Disease Case Study Dr. Wendy Good HSA 535: Managerial Epidemiology January 23, 2013 Introduction “Infectious diseases have probably been in existence as long as plants, animals, and humans have inhabited the planet” (Fleming, 2008, p.17). This case study will identify the transmission and symptoms of the flu, treatments that are currently available and how the organization can help mitigate the spread of this disease, develop four (4) questions or concerns that leadership in the organization will ask in regard to possible side effects of the treatments, propose three (3) lessons that have been learned from past flu seasons that will underscore the importance of preparing for the upcoming flu season and why these lessons are beneficial, propose two (2) recommendations to leadership on how to cope with the shortage of the flu vaccine, and compose an infection control policy for the local community. Identify The Transmission And Symptoms Of the Flu, Treatments That Are Currently Available, And How Your Organization Can Help Mitigate The Spread Of This Disease Influenza is a contagious respiratory illness caused by flu viruses and is often called flu. Flu is not a cold; it can be mild, severe and sometimes often results in death. When people got flu, they feel the following symptoms: • Fever or feeling feverish/chills • Cough • Sore throat • Runny or stuffy nose • Muscle or body......

Words: 1634 - Pages: 7

Premium Essay

Evidence-Based Practice and Alzheimer’s Disease

...EVIDENCE-BASED PRACTICE and ALZHEIMER’S DISEASE Introduction As defined in 2012 by the American Nurses Association, “nursing is the protection, promotion, and optimization of health and abilities, prevention of illness and injury, alleviation of suffering through the diagnosis and treatment of human response, and advocacy in the care of individuals, families, communities, and populations. “To deliver the best optimal treatment when performing their duties, nurses are taught to follow evidence-based practices (EBP). Following EBP when dealing with clients especially those affected by Alzheimer’s disease facilitates the nurse in performing his/her main responsibilities that include maintaining health promotion, risk reduction and disease management. Maintaining health promotion From Florence Nightingale era in the 19th century to today’s world, nursing has become a new field where it is just not described “as the action of putting the patient in the best condition for nature to act “(“Healing Environment,”2011). Nursing turned to an immense expertise where maintaining health promotion is a master key. Health promotion favors the enhancement of health and the setting up of plan for a healthy lifestyle and well-being (Potter and Perry, 2011). Examples of health promotion consist of encouraging immunizations and regular checkups. Risk reduction Many complications can be avoided by promoting risk...

Words: 1321 - Pages: 6

Premium Essay

Alzheimer's Disease

...Alzheimer’s disease HCA/240 Veronica Brinson Mary Lou. Jenkins August 25, 2013   Alzheimer’s disease is a chronic progressive deterioration of the brain leading to dementia, incapacitation, and death. Dementia is a condition marked by memory loss plus a minimum of one other cognitive impairment. Alzheimer’s disease has been referred to as both the plaque of the ages and the plague of the aged. Alzheimer’s disease was so poorly understood that people who suffered this dementia were label as tormented, affected, pixilated, weird, afflicted, senile, mad, crazy, and spellbound. People with Alzheimer disease were feared, avoided, ignored, and ridiculed. Years and years went by peoples suffered terrible inhuman treatment when their families hid them away from other family members, the public, restrained them at home, locked them up in rooms, and committed them to insane asylums. There are many symptoms follow a set course of decline. There are a wide spectrum of demented actions every person will exhibit every symptom is a downhill regression follow a general pattern of mental regression and physical decline. People with the Alzheimer’s disease the earlier symptoms are recognized the greater chances are to slow and prevent the progression of dementia. Symptoms of Alzheimer’s disease are short-term memory loss, confusion, disorientation, wandering, mood swing, sundowner’s syndrome, eating habits and weight loss(changes) personal care, depression,......

Words: 946 - Pages: 4

Premium Essay

Alzheimer's Disease

...Alzheimer’s Association Texas A&M University-Central Texas Kelvin Ray Phillips Alzheimer’s Association The Alzheimer's Association International Research Grant Program funds investigations that advance our understanding of Alzheimer's disease. The first grant in organization funded its first research grant, awarding a total of about $80,000 to a handful of investigators. This propelled the Association into the largest nonprofit funder of Alzheimer’s research, awarding over $300 million to more than 2,100 scientific investigations. Alzheimer’s Association is funded donations and grants. The Association is one of the few national programs that stand on its own, and meets the BBB Wise Giving Alliance’s Standard for Charity Accountability. Alzheimer’s Association was created to continue research and provide healthcare for the aging group of 50 and above that will slowly falling victim to a disease that gradually depletes your memory. Alzheimer’s Association is a nonprofit organization that provides families support, public awareness, and community education. The mission was providing leadership and support service for individual families while supporting the advancement of research of Alzheimer’s disease. Alzheimer’s Association, chapter 17th, which is located in central Texas was formed in the 1980s, and is a leading volunteer health organization Alzheimer’s care support and research. The......

Words: 486 - Pages: 2

Free Essay

Alzheimer's Disease

...There are many significant health issues that come with aging, one of which is Alzheimer’s disease. Alzheimer’s disease is an irreversible, progressive brain disease that slowly destroys the memory and thinking skills of its victims. Eventually victims of Alzheimer’s lose their ability to complete tasks of daily living (National Institute on Aging, 2013). The discovery of Alzheimer’s disease was made by Dr. Alois Alzheimer upon an examination of the brain of a woman who died of an unusual mental illness. The doctor saw changes in the tissue of the brain. The National Institute on Aging (2013) website states that the symptoms of the woman’s illness were: memory loss, language problems, and unpredictable behaviors. In the examination of the brain, the doctor found abnormal clumps and tangled bundles of fibers. The clumps are amyloid plaques and the tangled bundles of fibers are neurofibrillary tangles. These plaques and tangles are two of the main features that accompany Alzheimer’s disease. A third feature is the loss of connection between neurons (nerve cells) in the brain (National Institute on Aging, 2013). Developing some knowledge of what Alzheimer’s disease is will help people understand what the symptoms of the disease are, how the disease is diagnosed and what treatments can be used to help slow the progress of Alzheimer’s disease. Alzheimer’s disease: Symptoms The symptoms of Alzheimer’s disease are tricky and can be easily written off as a sign of aging. It is......

Words: 1809 - Pages: 8

Premium Essay

Alzheimer's Disease

...Alzheimer's disease Alzheimer’s disease is a progressive disease that is the most common form of dementia. Its onset affects 24.3 million people in the United States (Leifer, 2009, p. 588). The earlier symptoms of this disease are memory loss and decline of cognitive functions. These symptoms are often overlooked as the normal signs of aging. Alzheimer’s often is not diagnosed until it has progressed to the more debilitating stages. Fewer than 50% of people with the disease are currently diagnosed. Awareness of the pathology of the disease and understanding risk factors and early signs of Alzheimer’s is vital to prevention as well as providing a patient with an early successful treatment. There are multiple risk factors which contribute to Alzheimer’s disease, age being the greatest. Alzheimer’s disease is increasing in occurrence with 1 percent in adults’ age 60 years to nearly 45 percent in those age 85 years and older (Wierenga & Bondi, 2011, p. 37). There are genetic risk factors that also play a role with developing Alzheimer’s. Early-onset familial Alzheimer’s disease has been linked to the presence of genetic mutations on chromosomes 21, 14 and chromosomes 1. Mutations found on chromosome 19 are a well-known genetic risk factor for late onset Alzheimer’s disease and may be the cause for 50 percent of the risk for developing it. Additional risk factors include cerebrovascular disease such as stroke, atherosclerosis, cardiovascular disease, systolic hypertension...

Words: 879 - Pages: 4

Premium Essay

Alzheimer's Disease

...http://www.alz.org/alzheimers_disease_what_is_alzheimers.asp ALZHEIMER’S DISEASE * Alzheimer's is the most common form of dementia, a general term for memory loss and other intellectual abilities serious enough to interfere with daily life. Alzheimer's disease accounts for 60 to 80 percent of dementia cases.  Bottom of Form * Alzheimer's is not a normal part of aging, although the greatest known risk factor is increasing age, and the majority of people with Alzheimer's are 65 and older. But Alzheimer's is not just a disease of old age. Up to 5 percent of people with the disease have early onset Alzheimer's (also known as younger-onset), which often appears when someone is in their 40s or 50s. * Alzheimer's worsens over time. Alzheimer's is a progressive disease, where dementia symptoms gradually worsen over a number of years. In its early stages, memory loss is mild, but with late-stage Alzheimer's, individuals lose the ability to carry on a conversation and respond to their environment. Alzheimer's is the sixth leading cause of death in the United States. Those with Alzheimer's live an average of eight years after their symptoms become noticeable to others, but survival can range from four to 20 years, depending on age and other health conditions.  * Alzheimer's has no current cure, but treatments for symptoms are available and research continues. Although current Alzheimer's treatments cannot stop Alzheimer's from progressing, they can temporarily slow the......

Words: 6877 - Pages: 28

Premium Essay

Alzheimer’s Disease

...Alzheimer’s Disease Michael A. Smith HCS/245 May 26, 2014 Dr. Michelle Clemons Alzheimer’s Disease Alzheimer is a stage of dementia which ability of the brain appears to stop functioning, such as creating memory loss, judgment instability, lack emotions with reasoning and changes in behavior. This is found more common in the elderly population of people. Studies shows apparently some people over sixty-five develops forms of dementia with the increase in later years after eighty-five. The Alzheimer's disease can be found in millions of Americans and more prevalent amongst African-Americans than other races. Describing the disease This type if disease very complex and changing rapidly without much discovery concerning treatments. When the processing of some proteins experiences interference or goes wrong terribly, the development of Alzheimer disease starts to blossom. This activity caused the brain cells with space between them cluttered with toxic protein; resulting loss nerve cells in regions of the brain upon investigation by microscopes for clear venture would reveal it. Such clusters are of two forms: the ones found between cells and those inside nerve cells. The dying nerve cells communicate with neurotransmitter acetylcholine a compound that would break down an enzyme known as acetyl cholinesterase and other studies now suggests having high cholesterol and also blood pressure being too high can be contributing toward Alzheimer disease......

Words: 1097 - Pages: 5

Free Essay

Lyme Disease Case Study

...Case Study 1: In late September a woman brings her 14 yr old daughter to the family physician. The doctor examines the back of the daughter’s thigh where there are pale red, non-raise discolorations. The rash covers a wide area of the thigh and seems to be roughly circular. The center of the circular area appears normal. There are no other symptoms, but the rash has been present for over three weeks and it seems to be growing. The doctor questions about possible exposures. Has she worn any new pants lately? Has she been in the woods? Do her joints hurt? She tells him that she spent the month of August at summer camp in the mountains of Pennsylvania. She’s been wearing mostly shorts and bathing suits for the past two months, none of them new. She doesn’t remember any bites on her thigh. 1. On the basis of the oral history, what is the most likely diagnosis? What would the causative agent look like with gram stain? Lyme Disease is the most likely diagnosis (3). Borrelia burgdorferi will show up pink with gram stain because it is gram – (1). 2. How did she most likely acquire her infection? She most likely acquired the infection from an Ixodes tick bit (deer tick) at summer camp (1). 3. Would the diagnosis be any different if she had attended camp in Arizona? Explain. She may have still gotten a tick bite, but not by the same type of tick (4). In Pennsylvania, it was more than likely by a deer tick, resulting in Lyme Disease (1). In Arizona, she......

Words: 1219 - Pages: 5

Free Essay

Alzheimer's Disease

...the individuals, family caregivers and healthcare services for people having Alzheimer’s disease?” With prolonged life expectancy , the population of many developed countries are ageing recently. The prevalence of Alzheimer’s disease with the decline of cognitive abilities increases along with the aging population. There is also a rise of persons younger than 65 having this disease (Cox, 2013). Take Hong Kong as an example ,a research (Yu et al., 2012) estimated the number of people with dementia would rise from 103,433 in 2009 to 332,688 in 2039, with an increase of 222%. Consequently , this phenomenon has brought about an worldwide public health challenge to the individuals, family caregivers and healthcare services. Individuals having this disease face the problem of the loss of independence and dignity. LOPEZ (2003) examines that the major symptoms of Alzheimer’s disease are the significant memory loss , confusion , weaken communication and judgment ability. They have difficulty in doing familiar tasks and need to depend on others to take care of their daily lives such as dressing , toileting and eating. Moreover, Cox (2013) points out that those who are young may be forced to have involuntary retirement due to the inability in concentration , learning new things and making decisions. A sense of uselessness of the patients may arise. Family caregivers of patients with Alzheimer’s disease are facing the challenge of handling the physical and psychological burden.......

Words: 808 - Pages: 4

Free Essay

Alzheimer's Disease

...Amanda Farrington Research paper October 17, 2014 Despite the forgetfulness, we have of the seriousness of Alzheimer’s disease; the behind the scenes action is what we need to be taking a look at. Researcher is now choosing different routes of prevention, treatment and diagnostic studies to solve this serious illness. Which different stages of diagnosis it’s difficult to find the target of what triggers the disease. With the majority of patients being diagnosed being of the elderly stage of life, testing different options is risky because of old age. As many years and millions have gone on to find the cure to stop this tragic illness that overcomes thousands of loved ones every year, scientist have decided to step back and make a strategy. With so many failed attempts of curing this disease, they decided to find an attack approach before being diagnosed. Studies have gone into the smallest detail to find common traits that those diagnosed have. While this is an endless and tedious process, they continued. Scientist have discovered that there are ways to lower the risks of being diagnosed with the disease in the future. Although there is no cure once diagnosed, there have been studies found on how to lessen your chances of getting it. Multiple articles, including National Institute of Agings “alheimer’s prevention”, state that vitamins are always a natural and healthy route as well as anti inflammatory drugs. While a healthy diet and exercise can be effective...

Words: 1637 - Pages: 7

Premium Essay

Alzheimer's Disease

...Did you know that Alzheimer’s disease is the only cause of death in the top 10 in America that cannot be prevented, cured, or slowed? Alzheimer’s disease is a progressive disease that destroys memory and other important mental functions. It is the most common form of dementia. According to the Alzheimer’s Association, 1 in 3 senior citizens end up getting Alzheimer’s disease or another type of dementia in their lifetime. And many of those who have Alzheimer’s disease have not been diagnosed. Today I’m going to inform you on how to be able to distinguish Alzheimer’s disease through the causes, symptoms, along with further prevention, medication, and research.   Alzheimer’s is a tricky disease to find and understand because there are no direct causes with it. Doctor Alois Alzheimer was the first doctor to identify the first case of Alzheimer’s disease. He realized something was different with a woman’s brain tissue after she had passed away from an unusual mental illness. This woman’s name was Auguste Deter. Her symptoms were memory loss, language problems, and unusual behavior. Scientists have discovered that brain damage beings to start around a decade before the patient shows signs of memory loss. The beginning damage appears to take place in the hippocampus, which is that part of the brain that forms and keeps the memories. As more neurons become damaged, more and more parts of the brain are being affected. At the final stage of Alzheimer’s, the damage is all......

Words: 968 - Pages: 4

Free Essay

To Study the Precursor Protein of Alzheimer’s Disease – Beta Amyloid.

...Alzheimer’s disease is a wholesale loss of synapses, contact points via which nerve cells relay signals to one another and a parallel deterioration in brain function, notably in the ability to remember. Amyloid beta (Aβ) denotes peptides of 36–43 amino acids that are crucially involved in Alzheimer's disease as the main component of the amyloid plaques found in the brains of Alzheimer patients. The peptides result from the amyloid precursor protein (APP), which is being cut by certain enzymes to yield Aβ. Study has shown that Beta amyloid begins life as a solitary molecule but tends to bunch up , initially into small clusters that are still soluble and can travel freely in the brain, and finally into the plaques that are hallmarks of Alzheimer’s. The study showed for the first time that in this clustered form, beta-amyloid can bind strongly to a receptor on nerve cells, setting in motion an intercellular process that erodes their synapses with other nerve cells. Further looking into this protein and the information regarding it in various databases, the following was sequence was found out for the Beta amyloid A4 protein in Homo sapien in SWISSPROT. >sp|P05067|A4_HUMAN Amyloid beta A4 protein OS=Homo sapiens GN=APP PE=1 SV=3 MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTK TCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVG EFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFR GVEFVCCPLAEESDNVDSADAEEDDSDVWWGGADTDYADGSEDKVVEVAEEEEVAEVEEE E...

Words: 966 - Pages: 4

Free Essay

Pet Imaging and Alzheimer's Disease

...Alzheimer’s Disease is an irreversible, degenerative brain disease that is marked by the build up of plaque and tangles in the neurons of Alzheimer’s patients, which induce memory loss and inhibit mental functions. Estimates vary, but experts believe as many as 5.1 million Americans are currently suffering from Alzheimer’s (Alzheimer’s Fact Sheet). Although there is no cure for the disease, early detection of Alzheimer’s is crucial because it allows the patient to immediately begin a drug regimen that slows the process of the disease. In modern medicine, two types of PET imaging, fluorodeoxyglucose and amyloid, are the most effective methods of diagnosing Alzheimer’s Disease. The degenerative aspect of Alzheimer’s is caused by plaque and tangles in the nerve cells of the brain. Abnormal clusters of protein fragments called beta amyloid accumulate in the synaptic gap between neurons and block cell-to-cell signaling (Alzheimer’s Association). This build up of plaque may also activate an autoimmune response, which kills the deactivated cells (Medicine Net). Simultaneously, tangles in a protein called tau destroy a vital nerve cell transport system. Healthy transport systems are kept orderly and parallel by tau (Alzheimer’s Association). In Alzheimer’s patients, however, tau collapses in to twisted strands called tangles. The transport system can no longer stay parallel, which causes it to disintegrate. Key materials like food molecules and cell parts can no longer move through...

Words: 1957 - Pages: 8

Anmelden | GoPro Dual Battery Charger with Battery for HERO5 HERO6 HERO7 Blac AADBD-001 | Microsoft Office Picture Manager 2003